Structure of PDB 8iyj Chain S9 Binding Site BS01

Receptor Information
>8iyj Chain S9 (length=276) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLV
HDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQFTDDNVLRSQ
SERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIH
THLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELC
RDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVK
ANTLYIDQEKCMSMRNSYPSTLRLVG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iyj Structures of sperm flagellar doublet microtubules expand the genetic spectrum of male infertility.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		K239 A242 S246 L309 R310
Binding residue
(residue number reindexed from 1)		K78 A81 S85 L97 R98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0030317 flagellated sperm motility
GO:0060271 cilium assembly
GO:0060294 cilium movement involved in cell motility
GO:0060378 regulation of brood size
Cellular Component
GO:0001669 acrosomal vesicle
GO:0002080 acrosomal membrane
GO:0002081 outer acrosomal membrane
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005879 axonemal microtubule
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0031514 motile cilium
GO:0036126 sperm flagellum
GO:0160111 axonemal A tubule inner sheath

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iyj, PDBe:8iyj, PDBj:8iyj
PDBsum8iyj
PubMed37295417
UniProtQ6X6Z7|TEKT3_MOUSE Tektin-3 (Gene Name=Tekt3)

[Back to BioLiP]