Structure of PDB 8rct Chain S1 Binding Site BS01

Receptor Information
>8rct Chain S1 (length=83) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAV
HNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHA
Ligand information
>8rct Chain 41 (length=14) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGRVDRFNKRFNIP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rct Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
Resolution5.32 Å
Binding residue
(original residue number in PDB)		L5 G8 P9 P42 E65 V67
Binding residue
(residue number reindexed from 1)		L4 G7 P8 P41 E64 V66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rct, PDBe:8rct, PDBj:8rct
PDBsum8rct
PubMed38409277
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]