Structure of PDB 8r0a Chain S Binding Site BS01

Receptor Information
>8r0a Chain S (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIVFNATSEFCRTKEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHG
KGSGKMKTERRMKKLDEEALLKKMLGTVALLQEKQK
Ligand information
>8r0a Chain X (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NVSQKRKYRQYMNRKGGFNRPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r0a Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution5.8 Å
Binding residue
(original residue number in PDB)
R732 F733 H734
Binding residue
(residue number reindexed from 1)
R47 F48 H49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000481 maturation of 5S rRNA
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
GO:0045585 positive regulation of cytotoxic T cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8r0a, PDBe:8r0a, PDBj:8r0a
PDBsum8r0a
PubMed38778104
UniProtO43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 (Gene Name=SART1)

[Back to BioLiP]