Structure of PDB 8d9s Chain S Binding Site BS01

Receptor Information
>8d9s Chain S (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFV
DWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCE
LDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDMLQ
Ligand information
>8d9s Chain L (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGENTSLLHP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d9s Self-assembly and structure of a clathrin-independent AP-1:Arf1 tubular membrane coat.
Resolution20.0 Å
Binding residue
(original residue number in PDB)		Y62 V98 C99 E100
Binding residue
(residue number reindexed from 1)		Y62 V98 C99 E100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035615 clathrin adaptor activity
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0060155 platelet dense granule organization
GO:1903232 melanosome assembly
Cellular Component
GO:0000139 Golgi membrane
GO:0005765 lysosomal membrane
GO:0005769 early endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005905 clathrin-coated pit
GO:0030117 membrane coat
GO:0030121 AP-1 adaptor complex
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0032588 trans-Golgi network membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d9s, PDBe:8d9s, PDBj:8d9s
PDBsum8d9s
PubMed36269825
UniProtQ96PC3|AP1S3_HUMAN AP-1 complex subunit sigma-3 (Gene Name=AP1S3)

[Back to BioLiP]