Structure of PDB 8caz Chain S Binding Site BS01

Receptor Information
>8caz Chain S (length=83) Species: 679895 (Escherichia coli BW25113) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAV
HNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHA
Ligand information
>8caz Chain 4 (length=12) Species: 679895 (Escherichia coli BW25113) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRVDRFNKRFNI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8caz Structural conservation of antibiotic interaction with ribosomes.
Resolution2.11 Å
Binding residue
(original residue number in PDB)		L5 G8 P9 F41 P42 V67 G68
Binding residue
(residue number reindexed from 1)		L4 G7 P8 F40 P41 V66 G67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8caz, PDBe:8caz, PDBj:8caz
PDBsum8caz
PubMed37550453
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]