Structure of PDB 7egp Chain S Binding Site BS01

Receptor Information
>7egp Chain S (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7egp Chain W (length=166) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcctgaagct
tgtcgagaagtactag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7egp Structure of the SWI/SNF complex bound to the nucleosome and insights into the functional modularity.
Resolution6.9 Å
Binding residue
(original residue number in PDB)		R40 Y41 R42 G44 V46 R49 K56 R63 K64 L65 P66 R69 R83 T118
Binding residue
(residue number reindexed from 1)		R1 Y2 R3 G5 V7 R10 K17 R24 K25 L26 P27 R30 R44 T79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7egp, PDBe:7egp, PDBj:7egp
PDBsum7egp
PubMed33907182
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]