Structure of PDB 7a23 Chain S Binding Site BS01

Receptor Information
>7a23 Chain S (length=101) Species: 3712 (Brassica oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PCAHPEYLEAVPKATEYRLRCPATIDEEAIVPSSDPETVYNIVYHGRDQR
RNRPPIRRYVLTKDNVVQMMNEKKSFDVSDFPKVYLTTVEEDLDTRGGGY
E
Ligand information
>7a23 Chain r (length=24) Species: 3712 (Brassica oleracea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a23 Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		T116 E118 E119 D120 R124
Binding residue
(residue number reindexed from 1)		T88 E90 E91 D92 R96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005739 mitochondrion
GO:0005886 plasma membrane

View graph for
Cellular Component
External links
PDB RCSB:7a23, PDBe:7a23, PDBj:7a23
PDBsum7a23
PubMed33060577
UniProtQ9SD78

[Back to BioLiP]