Structure of PDB 6z1u Chain S Binding Site BS01

Receptor Information
>6z1u Chain S (length=187) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPK
MAASLLNPYVKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPA
VISAFSTMMSVHRGEVPCTVTTASALDEATLTELKTVLKSFLSKGQVLKL
EVKIDPSIMGGMIVRIGEKYVDMSAKTKIQKLSRAMR
Ligand information
>6z1u Chain h (length=22) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPVQKLFVDKIREYRTKRQTSG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z1u Structure of the dimeric ATP synthase from bovine mitochondria.
Resolution3.47 Å
Binding residue
(original residue number in PDB)		A175 L182 M186
Binding residue
(residue number reindexed from 1)		A175 L182 M186
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0015986 proton motive force-driven ATP synthesis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z1u, PDBe:6z1u, PDBj:6z1u
PDBsum6z1u
PubMed32900941
UniProtP13621|ATPO_BOVIN ATP synthase subunit O, mitochondrial (Gene Name=ATP5PO)

[Back to BioLiP]