Structure of PDB 6uao Chain S Binding Site BS01

Receptor Information

>6uao Chain S (length=266) Species: 1390 (Bacillus amyloliquefaciens)

AKCVSYGVAQIKAPALHSQGYTGSNVKVAILDTGIDSSHPDLNVAGGASF
VPSETNPFQDNSSGGTHIAGTVLAVAPSASLYAVKVLGADGKGQASWIIN
GIEWAIANNMDVINMSLGSPSGSAAVKAAVDKAVASGVVVVAAAGNSGTS
GSSSTVTYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTL
PGGKYGALSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGD
SFYYGKGLINVEAAAQ

Ligand information

>6uao Chain B (length=6) Species: 9606 (Homo sapiens)

EEYSAM

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6uao Engineering subtilisin proteases that specifically degrade active RAS.
• Resolution: 1.63 Å
• Binding residue (original residue number in PDB): G100 K101 G102 A104 W106 I107 S125 L126 G127 S128 G131 S132 N155 G219 T220 S221
• Binding residue (residue number reindexed from 1): G91 K92 G93 A95 W97 I98 S116 L117 G118 S119 G122 S123 N146 G210 T211 S212

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 12:19:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6uao', asym_id = 'S', bs = 'BS01', title = 'Engineering subtilisin proteases that specifically degrade active RAS.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6uao', asym_id='S', bs='BS01', title='Engineering subtilisin proteases that specifically degrade active RAS.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004252,0006508,0008236', uniprot = '', pdbid = '6uao', asym_id = 'S'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004252,0006508,0008236', uniprot='', pdbid='6uao', asym_id='S')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>