Structure of PDB 6rfk Chain S Binding Site BS01

Receptor Information
>6rfk Chain S (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKIT
VVAGEHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLV
LNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVFHQGQSALVLQYLRVPL
VDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVEGTSFLT
GIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rfk NMR resonance assignments of apo and EGRCK-inhibited factor IXa
Resolution1.6 Å
Binding residue
(original residue number in PDB)		H57 Y99 F174 D189 S190 C191 Q192 G193 S195 S214 W215 G216
Binding residue
(residue number reindexed from 1)		H41 Y86 F162 D179 S180 C181 Q182 G183 S185 S204 W205 G206
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195
Catalytic site (residue number reindexed from 1) H41 D89 Q182 G183 D184 S185
Enzyme Commision number 3.4.21.22: coagulation factor IXa.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6rfk, PDBe:6rfk, PDBj:6rfk
PDBsum6rfk
PubMed
UniProtP00740|FA9_HUMAN Coagulation factor IX (Gene Name=F9)

[Back to BioLiP]