Structure of PDB 6qx2 Chain S Binding Site BS01

Receptor Information
>6qx2 Chain S (length=184) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEK
ARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHI
RTLLLTFFYRFMRPLIEAGYVYIAQPPKGLEMNADQLWETTMNPEHRALL
QVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qx2 Structure-guided design of antibacterials that allosterically inhibit DNA gyrase.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
G436 D437 R458 G459 K460 D512
Binding residue
(residue number reindexed from 1)
G20 D21 R42 G43 K44 D96
Enzymatic activity
Enzyme Commision number 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524 ATP binding
Biological Process
GO:0006265 DNA topological change

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6qx2, PDBe:6qx2, PDBj:6qx2
PDBsum6qx2
PubMed30962087
UniProtP0A0K8|GYRB_STAAU DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]