Structure of PDB 6dff Chain S Binding Site BS01

Receptor Information
>6dff Chain S (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFV
DWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCE
LDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDMLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dff HIV-1 Nefs Are Cargo-Sensitive AP-1 Trimerization Switches in Tetherin Downregulation.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		S64 D92 V98 C99 E100 L101
Binding residue
(residue number reindexed from 1)		S64 D92 V98 C99 E100 L101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035615 clathrin adaptor activity
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0060155 platelet dense granule organization
GO:1903232 melanosome assembly
Cellular Component
GO:0000139 Golgi membrane
GO:0005765 lysosomal membrane
GO:0005769 early endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005905 clathrin-coated pit
GO:0030117 membrane coat
GO:0030121 AP-1 adaptor complex
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0032588 trans-Golgi network membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dff, PDBe:6dff, PDBj:6dff
PDBsum6dff
PubMed30053425
UniProtQ96PC3|AP1S3_HUMAN AP-1 complex subunit sigma-3 (Gene Name=AP1S3)

[Back to BioLiP]