Structure of PDB 6cnf Chain S Binding Site BS01

Receptor Information
>6cnf Chain S (length=217) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAAAAAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATAIQLKL
NPDGTMAIDEETMVVDRHKNASIENEYKEKVDENPFANLYNYGSYGRGSY
TDPWTVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEKKRP
ILIELALRSKLPPNFDEYCCEIKKNIGTVADFNEKLIELQNEHKHHMKEI
EEAKNTAKEEDQTAQRL
Ligand information
>6cnf Chain X (length=47) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttcaacatatattagtaatactttttctgccaagttggttaaggcgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cnf Structural visualization of RNA polymerase III transcription machineries.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		R413 G414 T417 N460
Binding residue
(residue number reindexed from 1)		R97 G98 T101 N144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001156 TFIIIC-class transcription factor complex binding
Biological Process
GO:0001112 DNA-templated transcription open complex formation
GO:0006355 regulation of DNA-templated transcription
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cnf, PDBe:6cnf, PDBj:6cnf
PDBsum6cnf
PubMed30083386
UniProtP46678|TFC5_YEAST Transcription factor TFIIIB component B'' (Gene Name=BDP1)

[Back to BioLiP]