Structure of PDB 5ylz Chain S Binding Site BS01

Receptor Information
>5ylz Chain S (length=207) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIYDMTSTNDVEFKKKIYLVLKSSLSGDEAAHKLLKLKIANNLKKSVVDI
IIKSSLQESTFSKFYSILSERMITFHRSWQTAYNETFEQNYTQDIEDYET
DQLRILGKFWGHLISYEFLPMDCLKIIKLTEEESCPQGRIFIKFLFQELV
NELGLDELQLRLNSSKLDGMFPLEGDAEHIRYSINFFTAIGLGLLTEDMR
SRLTIIQ
Ligand information
>5ylz Chain R (length=27) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SYNGIGLKSAKGSSTSGHVQRSLASNN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ylz Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
Resolution3.6 Å
Binding residue
(original residue number in PDB)		D306 H310 L313 K314
Binding residue
(residue number reindexed from 1)		D28 H32 L35 K36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005737 cytoplasm
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ylz, PDBe:5ylz, PDBj:5ylz
PDBsum5ylz
PubMed29153833
UniProtP53333|CWC22_YEAST Pre-mRNA-splicing factor CWC22 (Gene Name=CWC22)

[Back to BioLiP]