Structure of PDB 5wsg Chain S Binding Site BS01

Receptor Information
>5wsg Chain S (length=69) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKSWRKGTAFGRGY
INDMTKSEYHQEFLHKHVR
Ligand information
>5wsg Chain D (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaggucaacaucaagaacugugggccuuugccuauagaacuuauaacga
acaugguucuugccuuuuaccagaaccauccggguguugucuccauccau
auuuuuuggaacuuuuc
<<<<<.<<<<<<<.....<<<<<<<<....>>>>>>>>............
..<<<<<<<<...........>>>>>>>>...>>>>>>>>>>>>......
.................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wsg Structure of a yeast step II catalytically activated spliceosome
Resolution4.0 Å
Binding residue
(original residue number in PDB)		R29 P32 H34 T35
Binding residue
(residue number reindexed from 1)		R26 P29 H31 T32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wsg, PDBe:5wsg, PDBj:5wsg
PDBsum5wsg
PubMed27980089
UniProtQ03772|CWC15_YEAST Pre-mRNA-splicing factor CWC15 (Gene Name=CWC15)

[Back to BioLiP]