Structure of PDB 5w1v Chain S Binding Site BS01

Receptor Information
>5w1v Chain S (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLNQSPQSMFIQEGEDVSMNCTSSSIFNTWLWYKQDPGEGPVLLIALYKA
GELTSNGRLTAQFGITRKDSFLNISASIPSDVGIYFCAGQPLGGSNYKLT
FGKGTLLTVNPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKD
SDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
S
Ligand information
>5w1v Chain R (length=9) Species: 10360 (Human herpesvirus 5 strain AD169) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VMAPRTLIL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w1v A conserved energetic footprint underpins recognition of human leukocyte antigen-E by two distinct alpha beta T cell receptors.
Resolution3.31 Å
Binding residue
(original residue number in PDB)		G110 G111 S112 N113
Binding residue
(residue number reindexed from 1)		G93 G94 S95 N96
External links