Structure of PDB 4pyu Chain S Binding Site BS01

Receptor Information
>4pyu Chain S (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWY
TIFKDHVSLGDYEIHDGMNLELYYQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pyu The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
M1 K17 C18 N19 D22 D26 L30 A33 Q34
Binding residue
(residue number reindexed from 1)
M3 K19 C20 N21 D24 D28 L32 A35 Q36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0031386 protein tag activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0036211 protein modification process
GO:1903955 positive regulation of protein targeting to mitochondrion
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0015030 Cajal body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4pyu, PDBe:4pyu, PDBj:4pyu
PDBsum4pyu
PubMed24872507
UniProtQ9BZL1|UBL5_HUMAN Ubiquitin-like protein 5 (Gene Name=UBL5)

[Back to BioLiP]