Structure of PDB 4ce4 Chain S Binding Site BS01

Receptor Information
>4ce4 Chain S (length=94) Species: 9825 (Sus scrofa domesticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESV
GRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVL
Ligand information
>4ce4 Chain B (length=29) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuu
.............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ce4 Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		R85 T86 H89 R108 Y117 E152 S157
Binding residue
(residue number reindexed from 1)		R7 T8 H11 R30 Y39 E74 S79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ce4, PDBe:4ce4, PDBj:4ce4
PDBsum4ce4
PubMed24362565
UniProtA0A0R4J8D5

[Back to BioLiP]