Structure of PDB 3f1i Chain S Binding Site BS01

Receptor Information
>3f1i Chain S (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI
DRKHSELSELNVKVMEALSLYTKLMNE
Ligand information
>3f1i Chain C (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QMGPLIDEKLEDIDRKHSELSELN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3f1i Hybrid Structural Model of the Complete Human ESCRT-0 Complex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		H337 D344 L347 E348 D351 R352 H354 S355 S358 E359
Binding residue
(residue number reindexed from 1)		H37 D44 L47 E48 D51 R52 H54 S55 S58 E59
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3f1i, PDBe:3f1i, PDBj:3f1i
PDBsum3f1i
PubMed19278655
UniProtQ92783|STAM1_HUMAN Signal transducing adapter molecule 1 (Gene Name=STAM)

[Back to BioLiP]