Structure of PDB 2xb2 Chain S Binding Site BS01

Receptor Information
>2xb2 Chain S (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLDDDEDRKNPAYIPRKGLFFEHDLRGRWEHDKFREDEQAPKSRQELIAL
YGYDIRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xb2 Insights Into the Recruitment of the Nmd Machinery from the Crystal Structure of a Core Ejc-Upf3B Complex.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		L187 F188
Binding residue
(residue number reindexed from 1)		L19 F20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0035145 exon-exon junction complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xb2, PDBe:2xb2, PDBj:2xb2
PDBsum2xb2
PubMed20479275
UniProtO15234|CASC3_HUMAN Protein CASC3 (Gene Name=CASC3)

[Back to BioLiP]