Structure of PDB 2wpl Chain S Binding Site BS01

Receptor Information

>2wpl Chain S (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKIT
VVAGEHNIEETEHTEQKRNVIRIIPHHNFNAAINTYNHDIALLELDEPLV
LNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPL
VDRATCLRSTKFTITNNMFCAGFHEGGRDSCQGDSGGPHVTEVEGTSFLT
GIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT

Ligand information

>2wpl Chain L (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FPR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2wpl Structural Basis of the Cofactor- and Substrate-Assisted Activation of Human Coagulation Factor Ixa
Resolution	1.82 Å
Binding residue (original residue number in PDB)	H57 Y99 F174 D189 S190 S195 S214 W215 G216
Binding residue (residue number reindexed from 1)	H41 Y86 F162 D179 S180 S185 S204 W205 G206

Enzymatic activity

Enzyme Commision number

3.4.21.22: coagulation factor IXa.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2wpl, PDBe:2wpl, PDBj:2wpl
PDBsum	2wpl
PubMed	20004170
UniProt	P00740\|FA9_HUMAN Coagulation factor IX (Gene Name=F9)

[Back to BioLiP]