Structure of PDB 1z6o Chain S Binding Site BS01

Receptor Information

>1z6o Chain S (length=191) Species: 7111 (Trichoplusia ni)

TQCNVNPVQIPKDWITMHRSCRNSMRQQIQMEVGASLQYLAMGAHFSKDV
VNRPGFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSSLLQVRPPTRS
SWKGGVEALEHALSMESDVTKSIRNVIKACEDDSEFNDYHLVDYLTGDFL
EEQYKGQRDLAGKASTLKKLMDRHEALGEFIFDKKLLGIDV

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 1z6o Chain S Residue 300

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1z6o Crystal structure of a secreted insect ferritin reveals a symmetrical arrangement of heavy and light chains.
• Resolution: 1.91 Å
• Binding residue (original residue number in PDB): E32 E67 H70
• Binding residue (residue number reindexed from 1): E32 E67 H70
• Annotation score: 5

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0008198 ferrous iron binding
• GO:0008199 ferric iron binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion

Cellular Component

• GO:0005576 extracellular region
• GO:0005737 cytoplasm
• GO:0005794 Golgi apparatus

External links

• PDB: RCSB:1z6o, PDBe:1z6o, PDBj:1z6o
• PDBsum: 1z6o
• PubMed: 15896348
• UniProt: A0A7E5WTY7|FRIH_TRINI Ferritin heavy chain (Gene Name=Fer1HCH)