Structure of PDB 6oj2 Chain RZ Binding Site BS01

Receptor Information
>6oj2 Chain RZ (length=183) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSL
HASDLKLPPGVELAVSPEETIAAVVPPEDVEKL
Ligand information
>6oj2 Chain QY (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggcuauagcucagcugggagagcgcuugcauggcaugcaagaggucag
cgguucgaucccgcuuagcuccacc
<<<<<<...<<<<........>>>>.<<<<<<.....>>>>>>.....<<
<<<.......>>>>>.>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oj2 Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V180 E181 K182 L183
Binding residue
(residue number reindexed from 1)		V180 E181 K182 L183
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6oj2, PDBe:6oj2, PDBj:6oj2
PDBsum6oj2
PubMed32601241
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]