Structure of PDB 6lqq Chain RV Binding Site BS01

Receptor Information

>6lqq Chain RV (length=190) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PKTQPKVIRFNGPSDVYVPPSKKTQKLLRSENLQNDLELQQFLRESHLLS
AFNGIVYQDDQVIGKARSRTLEMRLNRLSRVNGHQDKINKLEKVPMHIRR
GMIDKHVKRIKKYEQEAAEGGIVLSKVKKGQFRKIESTYKKDIERRIGGS
IKARDKEKATKRERGLKISSVGRSTRNGLIVSKRDIARIS

Ligand information

>6lqq Chain 3A (length=175) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guacccagugagaaauugccguugcuauggcgcgaugaucacccaugggu
ggguacaaauggcagucugacaagu

..................................................
.......................<<<<<.................<<<<<
<<<<<..<.........<<<<......>>>>.......>.<<<<..>>>>
.>>>>>>>>.>>........>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6lqq Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Resolution	4.1 Å
Binding residue (original residue number in PDB)	H224 M236
Binding residue (residue number reindexed from 1)	H84 M96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003674	molecular_function

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lqq, PDBe:6lqq, PDBj:6lqq
PDBsum	6lqq
PubMed	32943522
UniProt	P40546\|FAF1_YEAST Protein FAF1 (Gene Name=FAF1)

[Back to BioLiP]