Structure of PDB 6lqv Chain RQ Binding Site BS01

Receptor Information
>6lqv Chain RQ (length=138) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EHNHASAFTRTQDVPQTELQEKVDQVLQESNLANPEKDSKFEELPEEMRK
RTTEMRLMRELMFREERKARRLKKIKSKTYRKILQNVIINEKVNKKNLKY
QSSAVPFPFENREQYERSLRMPIGQEWTSRASHQELIK
Ligand information
>6lqv Chain 5A (length=171) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcgaaagcaguugaagacaaguggcuugucguucguuaauggccucguc
cagcgaaggauuugguggauuacuagcuaauagcaaucuaggaaacucaa
agagugcuaugguauggugacggagugcgcugugaacagagagcauuucc
ggcagcagagauuucagcugu
<<<....>>>...<<<<<<<<<<.>>>>>>>.>>>...............
.........................<<<...>>>................
....................<<<<.<<<.<<......>>...>>>..>>>
><<<<<.<<<..>>>.>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqv Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		E320 H321 N322 H323 S325 D332 M373 R872 Q876 K880
Binding residue
(residue number reindexed from 1)		E1 H2 N3 H4 S6 D13 M48 R130 Q134 K138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
GO:0005524 ATP binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lqv, PDBe:6lqv, PDBj:6lqv
PDBsum6lqv
PubMed32943522
UniProtQ04500|UTP14_YEAST U3 small nucleolar RNA-associated protein 14 (Gene Name=UTP14)

[Back to BioLiP]