Structure of PDB 4w4g Chain R1 Binding Site BS01

Receptor Information
>4w4g Chain R1 (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL
Ligand information
>4w4g Chain QW (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4w4g Defining the mRNA recognition signature of a bacterial toxin protein.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
G22 V30
Binding residue
(residue number reindexed from 1)
G21 V29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4w4g, PDBe:4w4g, PDBj:4w4g
PDBsum4w4g
PubMed26508639
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]