Structure of PDB 9gd2 Chain R Binding Site BS01

Receptor Information
>9gd2 Chain R (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGV
Ligand information
>9gd2 Chain S (length=14) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRFSNRQNKTVNYN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9gd2 Resolution of transcription-induced hexasome-nucleosome complexes by Chd1 and FACT.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		E56 Y57 E61 E64 L65 N68 A69 D72 K74 N89 D90 E92
Binding residue
(residue number reindexed from 1)		E42 Y43 E47 E50 L51 N54 A55 D58 K60 N75 D76 E78
External links
PDB RCSB:9gd2, PDBe:9gd2, PDBj:9gd2
PDBsum9gd2
PubMed39270644
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]