Structure of PDB 9bkk Chain R Binding Site BS01

Receptor Information

>9bkk Chain R (length=283) Species: 9606 (Homo sapiens)

EWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSD
LMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTLNLVAIAL
ERYSAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTK
NNNQTANMCRFLLPNDVMQQSWHTFLLLLLFFIPGVVMAVAYGLISLELY
QLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPIS
FILLLSYTSSCVNPIIYCFMNKRFRLGFMATFP

Ligand information

>9bkk Chain P (length=8) Species: 9606 (Homo sapiens)

DYMGWMDF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 9bkk Cholesterol-dependent dynamic changes in the conformation of the type 1 cholecystokinin receptor affect ligand binding and G protein coupling
• Resolution: 2.51 Å
• Binding residue (original residue number in PDB): E38 N98 P101 K105 D106 M121 Y176 M195 C196 R197 L213 F330 N333 R336 E344 S348 I352 Y360
• Binding residue (residue number reindexed from 1): E1 N61 P64 K68 D69 M84 Y139 M158 C159 R160 L176 F227 N230 R233 E241 S245 I249 Y257

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004951 cholecystokinin receptor activity
• GO:0017046 peptide hormone binding
• GO:0042277 peptide binding

Biological Process

• GO:0001764 neuron migration
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
• GO:0007409 axonogenesis
• GO:0030900 forebrain development
• GO:0032870 cellular response to hormone stimulus
• GO:0038188 cholecystokinin signaling pathway
• GO:0046883 regulation of hormone secretion

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:9bkk, PDBe:9bkk, PDBj:9bkk
• PDBsum: 9bkk
• PubMed: 39083706
• UniProt: P32238|CCKAR_HUMAN Cholecystokinin receptor type A (Gene Name=CCKAR)