Structure of PDB 8xzh Chain R Binding Site BS01

Receptor Information
>8xzh Chain R (length=303) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSRSADIFIASLA
VADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTG
LSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGD
LENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYF
FIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYM
LGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTS
MLC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xzh Cryo-EM structure of the MM07-bound human APLNR-Gi complex
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y93 I109 F110 V164 R168 C181 M183 W195 E198 Y271 F291 Y299
Binding residue
(residue number reindexed from 1)		Y71 I87 F88 V142 R146 C159 M161 W173 E176 Y249 F269 Y277
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0038023 signaling receptor activity
GO:0060182 apelin receptor activity
Biological Process
GO:0001525 angiogenesis
GO:0001568 blood vessel development
GO:0001570 vasculogenesis
GO:0001944 vasculature development
GO:0001947 heart looping
GO:0003171 atrioventricular valve development
GO:0003272 endocardial cushion formation
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007369 gastrulation
GO:0007507 heart development
GO:0007512 adult heart development
GO:0010468 regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0035886 vascular associated smooth muscle cell differentiation
GO:0035904 aorta development
GO:0043951 negative regulation of cAMP-mediated signaling
GO:0045766 positive regulation of angiogenesis
GO:0050878 regulation of body fluid levels
GO:0051281 positive regulation of release of sequestered calcium ion into cytosol
GO:0060183 apelin receptor signaling pathway
GO:0060412 ventricular septum morphogenesis
GO:0060841 venous blood vessel development
GO:0060976 coronary vasculature development
GO:1903589 positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:1903596 regulation of gap junction assembly
GO:1904022 positive regulation of G protein-coupled receptor internalization
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xzh, PDBe:8xzh, PDBj:8xzh
PDBsum8xzh
PubMed38428423
UniProtP35414|APJ_HUMAN Apelin receptor (Gene Name=APLNR)

[Back to BioLiP]