Structure of PDB 8wss Chain R Binding Site BS01

Receptor Information

>8wss Chain R (length=283) Species: 9606 (Homo sapiens)

YINIIMPSVFGTICLLGIIGNSTVIFAVVKKSCNNVPDIFIINLSVVDLL
FLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDR
YLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGA
VGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAP
ASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVL

Ligand information

>8wss Chain L (length=17) Species: 9606 (Homo sapiens)

FDMLRCMLGRVYRPCWQ

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8wss Mechanisms of ligand recognition and activation of melanin-concentrating hormone receptors.
• Resolution: 3.01 Å
• Binding residue (original residue number in PDB): F161 Q171 D192 Q196 I254 F256 C263 I265 R266 L274 Q348 R353 Y362
• Binding residue (residue number reindexed from 1): F51 Q61 D82 Q86 I144 F146 C153 I155 R156 L164 Q238 R243 Y252

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0005102 signaling receptor binding
• GO:0008188 neuropeptide receptor activity
• GO:0030273 melanin-concentrating hormone receptor activity
• GO:0042562 hormone binding
• GO:0042923 neuropeptide binding

Biological Process

• GO:0006091 generation of precursor metabolites and energy
• GO:0007166 cell surface receptor signaling pathway
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
• GO:0007204 positive regulation of cytosolic calcium ion concentration
• GO:0007218 neuropeptide signaling pathway
• GO:0007631 feeding behavior
• GO:0051928 positive regulation of calcium ion transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0005929 cilium
• GO:0043005 neuron projection
• GO:0060170 ciliary membrane
• GO:0097730 non-motile cilium

External links

• PDB: RCSB:8wss, PDBe:8wss, PDBj:8wss
• PDBsum: 8wss
• PubMed: 38710677
• UniProt: Q99705|MCHR1_HUMAN Melanin-concentrating hormone receptor 1 (Gene Name=MCHR1)