Structure of PDB 8wlh Chain R Binding Site BS01

Receptor Information
>8wlh Chain R (length=108) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLK
GMMNVLQG
Ligand information
>8wlh Chain e (length=16) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGGVPGALSNQPAPPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wlh Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state
Resolution3.7 Å
Binding residue
(original residue number in PDB)
P36 L95 D96
Binding residue
(residue number reindexed from 1)
P34 L67 D68
External links
PDB RCSB:8wlh, PDBe:8wlh, PDBj:8wlh
PDBsum8wlh
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]