Structure of PDB 8u26 Chain R Binding Site BS01

Receptor Information
>8u26 Chain R (length=284) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLV
NLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYS
MTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTE
TMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGIT
LWQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQV
YLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u26 Improving resolution and resolvability of single-particle cryoEM structures using Gaussian mixture models.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		F25 N85 N89 Y92 N96 M174 R177 M181 F268 Q284 Y287
Binding residue
(residue number reindexed from 1)		F3 N63 N67 Y70 N74 M152 R155 M159 F232 Q248 Y251
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004995 tachykinin receptor activity
GO:0005515 protein binding
GO:0016496 substance P receptor activity
Biological Process
GO:0002118 aggressive behavior
GO:0002687 positive regulation of leukocyte migration
GO:0003051 angiotensin-mediated drinking behavior
GO:0006954 inflammatory response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007217 tachykinin receptor signaling pathway
GO:0007611 learning or memory
GO:0007616 long-term memory
GO:0008217 regulation of blood pressure
GO:0008306 associative learning
GO:0009582 detection of abiotic stimulus
GO:0009725 response to hormone
GO:0010193 response to ozone
GO:0010634 positive regulation of epithelial cell migration
GO:0010996 response to auditory stimulus
GO:0014070 response to organic cyclic compound
GO:0014910 regulation of smooth muscle cell migration
GO:0032224 positive regulation of synaptic transmission, cholinergic
GO:0032230 positive regulation of synaptic transmission, GABAergic
GO:0032355 response to estradiol
GO:0032570 response to progesterone
GO:0035094 response to nicotine
GO:0035106 operant conditioning
GO:0042713 sperm ejaculation
GO:0042755 eating behavior
GO:0043117 positive regulation of vascular permeability
GO:0045471 response to ethanol
GO:0045760 positive regulation of action potential
GO:0045777 positive regulation of blood pressure
GO:0045778 positive regulation of ossification
GO:0045907 positive regulation of vasoconstriction
GO:0046887 positive regulation of hormone secretion
GO:0048265 response to pain
GO:0048266 behavioral response to pain
GO:0048660 regulation of smooth muscle cell proliferation
GO:0050671 positive regulation of lymphocyte proliferation
GO:0050679 positive regulation of epithelial cell proliferation
GO:0051496 positive regulation of stress fiber assembly
GO:0051602 response to electrical stimulus
GO:0060083 smooth muscle contraction involved in micturition
GO:0070472 regulation of uterine smooth muscle contraction
GO:0070474 positive regulation of uterine smooth muscle contraction
GO:1902093 positive regulation of flagellated sperm motility
Cellular Component
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0030425 dendrite
GO:0036126 sperm flagellum
GO:0044297 cell body
GO:0045211 postsynaptic membrane
GO:0061827 sperm head
GO:0071944 cell periphery
GO:0097225 sperm midpiece

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8u26, PDBe:8u26, PDBj:8u26
PDBsum8u26
PubMed37973972
UniProtP25103|NK1R_HUMAN Substance-P receptor (Gene Name=TACR1)

[Back to BioLiP]