Structure of PDB 8sg1 Chain R Binding Site BS01

Receptor Information

>8sg1 Chain R (length=279) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMKKTVNMVWFLNLAVAD
FLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTIISS
DRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANLHG
KISCFNNFSLSDPVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQ
RNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGL
PLATALAIANSCMNPILYVFMGQDFKKFK

Ligand information

>8sg1 Chain L (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YFPGQFAFS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8sg1 Cryo-EM structure of CMKLR1 signaling complex
Resolution	2.94 Å
Binding residue (original residue number in PDB)	H95 Y103 I120 R178 F190 N191 H217 R224 Y276
Binding residue (residue number reindexed from 1)	H60 Y68 I85 R143 F155 N156 H169 R176 Y228

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8sg1, PDBe:8sg1, PDBj:8sg1
PDBsum	8sg1
PubMed	38055679
UniProt	Q99788\|CML1_HUMAN Chemerin-like receptor 1 (Gene Name=CMKLR1)

[Back to BioLiP]