Structure of PDB 8s5n Chain R Binding Site BS01

Receptor Information
>8s5n Chain R (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGR
TEVSFTLNEDLANEHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAEC
RPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYE
RKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEI
LKEIGVQNVKGIHKNTWELKPE
Ligand information
>8s5n Chain N (length=53) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaggggggctataaaagggggtgggggcgaattttgacagcgagggcca
gca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8s5n Three-step mechanism of promoter escape by RNA polymerase II
Resolution3.4 Å
Binding residue
(original residue number in PDB)
K174 R175 R177 P209
Binding residue
(residue number reindexed from 1)
K158 R159 R161 P193
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005674 transcription factor TFIIF complex
GO:0015630 microtubule cytoskeleton

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8s5n, PDBe:8s5n, PDBj:8s5n
PDBsum8s5n
PubMed38604172
UniProtP13984|T2FB_HUMAN General transcription factor IIF subunit 2 (Gene Name=GTF2F2)

[Back to BioLiP]