Structure of PDB 8qpk Chain R Binding Site BS01

Receptor Information
>8qpk Chain R (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRT
GKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVR
KKQKEK
Ligand information
>8qpk Chain 4 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugaggucuauccgaggcgcg
auuugcuaauugaaaacuucccaaua
....................<<<<.<<......<<.....>>...>>>>>
>.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qpk Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution4.2 Å
Binding residue
(original residue number in PDB)		G386 I413 G423 Y424 F426 R455 W459
Binding residue
(residue number reindexed from 1)		G18 I45 G55 Y56 F58 R87 W91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0048025 negative regulation of mRNA splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpk, PDBe:8qpk, PDBj:8qpk
PDBsum8qpk
PubMed38778104
UniProtQ9BTD8|RBM42_HUMAN RNA-binding protein 42 (Gene Name=RBM42)

[Back to BioLiP]