Structure of PDB 8qp8 Chain R Binding Site BS01

Receptor Information
>8qp8 Chain R (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRT
GKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVR
KKQKEK
Ligand information
>8qp8 Chain 6 (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuggaaaagauuagcauggccccugcgcaaggaugac
.....................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qp8 Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution3.5 Å
Binding residue
(original residue number in PDB)		S449 R450 P451
Binding residue
(residue number reindexed from 1)		S81 R82 P83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0048025 negative regulation of mRNA splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qp8, PDBe:8qp8, PDBj:8qp8
PDBsum8qp8
PubMed38778104
UniProtQ9BTD8|RBM42_HUMAN RNA-binding protein 42 (Gene Name=RBM42)

[Back to BioLiP]