Structure of PDB 8k9l Chain R Binding Site BS01

Receptor Information

>8k9l Chain R (length=282) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALA
DALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIWTLCTMSV
DRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQG
SIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVR
MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTF
QTVSWHFCIALGYTNSCLNPVLYAFLDENFKR

Ligand information

>8k9l Chain S (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YAGFG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8k9l Structural and dynamic insights into the activation of the mu-opioid receptor by an allosteric modulator.
Resolution	3.05 Å
Binding residue (original residue number in PDB)	Q126 I146 C219 V238 V302 W320 I324 Y328
Binding residue (residue number reindexed from 1)	Q61 I81 C154 V173 V237 W255 I259 Y263

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:8k9l, PDBe:8k9l, PDBj:8k9l
PDBsum	8k9l
PubMed	38740791
UniProt	P0ABE7\|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC); P35372\|OPRM_HUMAN Mu-type opioid receptor (Gene Name=OPRM1)

[Back to BioLiP]