Structure of PDB 8jrv Chain R Binding Site BS01

Receptor Information
>8jrv Chain R (length=319) Species: 9606,392809 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVMDFLFEKWKLYGDQCHHNLEIEVQKEVAKMYSSFQVMYTVGYSLSLGA
LLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTRYSQK
IGDSTWLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLP
ERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDNMGFWWILRF
PVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLG
VHEVVFAFSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL
GKVLWEEESCTTASSSLAK
Ligand information
>8jrv Chain G (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSQGTFTSDYSKYLDSRRAQDFVQW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jrv Tail engagement of arrestin at the glucagon receptor.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y138 L198 Y202 W304
Binding residue
(residue number reindexed from 1)		Y33 L93 Y97 W195
Enzymatic activity
Enzyme Commision number ?
3.4.21.69: protein C (activated).
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0017046 peptide hormone binding
GO:0038023 signaling receptor activity
Biological Process
GO:0006091 generation of precursor metabolites and energy
GO:0006887 exocytosis
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007584 response to nutrient
GO:0008217 regulation of blood pressure
GO:0009267 cellular response to starvation
GO:0009755 hormone-mediated signaling pathway
GO:0010628 positive regulation of gene expression
GO:0042593 glucose homeostasis
GO:0042594 response to starvation
GO:0070873 regulation of glycogen metabolic process
GO:0071377 cellular response to glucagon stimulus
Cellular Component
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jrv, PDBe:8jrv, PDBj:8jrv
PDBsum8jrv
PubMed37558880
UniProtP03435;
P04070|PROC_HUMAN Vitamin K-dependent protein C (Gene Name=PROC);
P30518|V2R_HUMAN Vasopressin V2 receptor (Gene Name=AVPR2);
P47871|GLR_HUMAN Glucagon receptor (Gene Name=GCGR)

[Back to BioLiP]