Structure of PDB 8jit Chain R Binding Site BS01

Receptor Information
>8jit Chain R (length=395) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTT
ANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGE
EIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAI
HANLFASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRV
AAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPM
LFVVPWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIV
QLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQGT
LRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLG
Ligand information
>8jit Chain P (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSQGTFTSDKSEYLDSERARDFVAWLEAG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jit Structural analysis of the dual agonism at GLP-1R and GCGR.
Resolution2.91 Å
Binding residue
(original residue number in PDB)		Q27 V28 M29 W36 K64 Y65 Q131 A135 Y138 Q142 Y145 Y149 V191 I206 G207 W215 I235 T296 N298 W304 V311 R378 K381 D385 L386
Binding residue
(residue number reindexed from 1)		Q1 V2 M3 W10 K38 Y39 Q105 A109 Y112 Q116 Y119 Y123 V165 I180 G181 W189 I209 T270 N272 W278 V285 R352 K355 D359 L360
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0017046 peptide hormone binding
GO:0038023 signaling receptor activity
Biological Process
GO:0006091 generation of precursor metabolites and energy
GO:0006887 exocytosis
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007584 response to nutrient
GO:0008217 regulation of blood pressure
GO:0009267 cellular response to starvation
GO:0009755 hormone-mediated signaling pathway
GO:0010628 positive regulation of gene expression
GO:0042593 glucose homeostasis
GO:0042594 response to starvation
GO:0070873 regulation of glycogen metabolic process
GO:0071377 cellular response to glucagon stimulus
Cellular Component
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jit, PDBe:8jit, PDBj:8jit
PDBsum8jit
PubMed37549266
UniProtP47871|GLR_HUMAN Glucagon receptor (Gene Name=GCGR)

[Back to BioLiP]