Structure of PDB 8jiq Chain R Binding Site BS01

Receptor Information
>8jiq Chain R (length=379) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTT
ANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGE
EIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAI
HANLFASFVLKASSVLVIDGLLRTRYSQKIGDDTWLSDGAVAGCRVAAVF
MQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVV
PWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLV
AKLRARQMHYKFRLAKSTLTLIPLLGVHEVVFAFVGTLRSAKLFFDLFLS
SFQGLLVAVLYCFLNKEVQSELRRRWHRW
Ligand information
>8jiq Chain E (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSQGTFTSDYSKYLDEQAAKEFIAWLMNT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jiq Structural analysis of the dual agonism at GLP-1R and GCGR.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Q27 M29 L32 D63 K64 R111 G112 W115 S119 A135 Y138 Q142 Y145 R199 Y202 G207 D208 D209 T296 S297 N298 W304 R308 V311 D385
Binding residue
(residue number reindexed from 1)		Q1 M3 L6 D37 K38 R85 G86 W89 S93 A109 Y112 Q116 Y119 R173 Y176 G181 D182 D183 T266 S267 N268 W274 R278 V281 D346
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0017046 peptide hormone binding
GO:0038023 signaling receptor activity
Biological Process
GO:0006091 generation of precursor metabolites and energy
GO:0006887 exocytosis
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007584 response to nutrient
GO:0008217 regulation of blood pressure
GO:0009267 cellular response to starvation
GO:0009755 hormone-mediated signaling pathway
GO:0010628 positive regulation of gene expression
GO:0042593 glucose homeostasis
GO:0042594 response to starvation
GO:0070873 regulation of glycogen metabolic process
GO:0071377 cellular response to glucagon stimulus
Cellular Component
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jiq, PDBe:8jiq, PDBj:8jiq
PDBsum8jiq
PubMed37549266
UniProtP47871|GLR_HUMAN Glucagon receptor (Gene Name=GCGR)

[Back to BioLiP]