Structure of PDB 8jip Chain R Binding Site BS01

Receptor Information
>8jip Chain R (length=386) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGS
FVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEEP
EEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASF
ILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCV
AANYYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIV
KYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKA
NLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTE
LSFTSFQGLMVAILYCFVNNEVQLEFRKSWERWRLE
Ligand information
>8jip Chain P (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSQGTFTSDKSEYLDSERAQDFVAWLEAG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jip Structural analysis of the dual agonism at GLP-1R and GCGR.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		S31 W39 E68 Y69 Y88 L89 E138 Y148 K197 Y205 S206 W214 V237 T298 R299 W306 R380 L384 E387 L388
Binding residue
(residue number reindexed from 1)		S2 W10 E39 Y40 Y59 L60 E101 Y111 K160 Y168 S169 W177 V200 T261 R262 W269 R343 L347 E350 L351
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0005515 protein binding
GO:0017046 peptide hormone binding
GO:0038023 signaling receptor activity
GO:0044508 glucagon-like peptide 1 receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007611 learning or memory
GO:0008016 regulation of heart contraction
GO:0019933 cAMP-mediated signaling
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0045776 negative regulation of blood pressure
GO:0045777 positive regulation of blood pressure
GO:0046879 hormone secretion
GO:0071377 cellular response to glucagon stimulus
GO:1990911 response to psychosocial stress
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jip, PDBe:8jip, PDBj:8jip
PDBsum8jip
PubMed37549266
UniProtP43220|GLP1R_HUMAN Glucagon-like peptide 1 receptor (Gene Name=GLP1R)

[Back to BioLiP]