Structure of PDB 8inr Chain R Binding Site BS01

Receptor Information
>8inr Chain R (length=271) Species: 9606,392809 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IAVEVFLTLGVISLLENILVIGAIVKNKNLHSPMYFFVCSLAVADMLVSM
SSAWETITIYLLNNKHLVIADAFVRHIDNVFDSMICISVVASMCSLLAIA
VDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILYSESTYVI
LCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASRTSMQGAVTVT
MLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMD
PLIYAFRSQEMRKTFKEIICC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8inr Structural insights into ligand recognition and subtype selectivity of the human melanocortin-3 and melanocortin-5 receptors.
Resolution2.73 Å
Binding residue
(original residue number in PDB)		E92 I96 R112 D115 N116 D119 I122 C123 I178 S181 I187 M261 F277 N278
Binding residue
(residue number reindexed from 1)		E55 I59 R75 D78 N79 D82 I85 C86 I141 S144 I150 M220 F236 N237
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004977 melanocortin receptor activity
GO:0005515 protein binding
GO:0042562 hormone binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0019222 regulation of metabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8inr, PDBe:8inr, PDBj:8inr
PDBsum8inr
PubMed37524700
UniProtP03435;
P33032

[Back to BioLiP]