Structure of PDB 8ibv Chain R Binding Site BS01

Receptor Information
>8ibv Chain R (length=279) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CSPFPLGALVPVTAVCLCLFVVGVSGNVVTVMLIGRYRDMRTTTNLYLGS
MAVSDLLILLGLPFDLYRLWRSRPWVFGPLLCRLSLYVGEGCTYATLLHM
TALSVERYLAICRPVTRRRVRALIAVLWAVALLSAGPFLFLVGVEQDAEA
AALFSRECRPSPAQLGALRVMLWVTTAYFFLPFLCLSILYGLIGRELWSG
HRQTVRVLLVVVLAFIICWLPFHVGRIIYINTEDSRMMYFSQYFNIVALQ
LFYLSASINPILYNLISKKYRAAAFKLLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ibv Structural basis for motilin and erythromycin recognition by motilin receptor.
Resolution3.19 Å
Binding residue
(original residue number in PDB)		S101 D182 R236 R318 Y321 D326 M330 Q334 N337 L341
Binding residue
(residue number reindexed from 1)		S72 D147 R159 R226 Y229 D234 M238 Q242 N245 L249
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005506 iron ion binding
GO:0008528 G protein-coupled peptide receptor activity
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0042562 hormone binding
GO:0046872 metal ion binding
Biological Process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0022900 electron transport chain
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ibv, PDBe:8ibv, PDBj:8ibv
PDBsum8ibv
PubMed36921049
UniProtO43193;
P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)

[Back to BioLiP]