Structure of PDB 8gy7 Chain R Binding Site BS01

Receptor Information
>8gy7 Chain R (length=274) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLA
ISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGS
IFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVI
FSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKG
AITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMC
NAVIDPFIYAFRSPELRDAFKKMI
Ligand information
>8gy7 Chain M (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SYSMEHFRWGKPVGKKRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gy7 Structural basis of signaling regulation of the human melanocortin-2 receptor by MRAP1.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		E28 F31 Y76 K77 E80 I84 R87 R95 E99 T100 A102 D103 D107 F110 V111 V166 S169 H170 F235 H238 M242 F258 G262
Binding residue
(residue number reindexed from 1)		E11 F14 Y59 K60 E63 I67 R70 R78 E82 T83 A85 D86 D90 F93 V94 V149 S152 H153 F218 H221 M225 F241 G245
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004977 melanocortin receptor activity
GO:0004978 corticotropin receptor activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0019222 regulation of metabolic process
GO:0022900 electron transport chain
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gy7, PDBe:8gy7, PDBj:8gy7
PDBsum8gy7
PubMed36588120
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
Q01718

[Back to BioLiP]