Structure of PDB 8f7w Chain R Binding Site BS01

Receptor Information
>8f7w Chain R (length=286) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADA
LVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDR
YIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVD
VIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSV
RLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSTSHST
AALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f7w Structures of the entire human opioid receptor family.
Resolution3.19 Å
Binding residue
(original residue number in PDB)		D138 Y139 M142 C210 Y219 E297 H304 L309 Y312 I316
Binding residue
(residue number reindexed from 1)		D82 Y83 M86 C154 Y163 E241 H248 L253 Y256 I260
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004985 G protein-coupled opioid receptor activity
GO:0005515 protein binding
GO:0033612 receptor serine/threonine kinase binding
GO:0038048 dynorphin receptor activity
GO:0042923 neuropeptide binding
Biological Process
GO:0006955 immune response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007268 chemical synaptic transmission
GO:0007600 sensory perception
GO:0007626 locomotory behavior
GO:0019233 sensory perception of pain
GO:0031635 adenylate cyclase-inhibiting opioid receptor signaling pathway
GO:0032868 response to insulin
GO:0033603 positive regulation of dopamine secretion
GO:0033685 negative regulation of luteinizing hormone secretion
GO:0035094 response to nicotine
GO:0038003 G protein-coupled opioid receptor signaling pathway
GO:0042220 response to cocaine
GO:0042711 maternal behavior
GO:0042755 eating behavior
GO:0043627 response to estrogen
GO:0044849 estrous cycle
GO:0045471 response to ethanol
GO:0046877 regulation of saliva secretion
GO:0048148 behavioral response to cocaine
GO:0050951 sensory perception of temperature stimulus
GO:0051607 defense response to virus
GO:0071222 cellular response to lipopolysaccharide
GO:0071333 cellular response to glucose stimulus
GO:1900745 positive regulation of p38MAPK cascade
GO:1901381 positive regulation of potassium ion transmembrane transport
GO:1903937 response to acrylamide
GO:1904000 positive regulation of eating behavior
GO:1990708 conditioned place preference
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016529 sarcoplasmic reticulum
GO:0030315 T-tubule
GO:0030425 dendrite
GO:0030672 synaptic vesicle membrane
GO:0042383 sarcolemma
GO:0042734 presynaptic membrane
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043204 perikaryon
GO:0043679 axon terminus
GO:0045211 postsynaptic membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8f7w, PDBe:8f7w, PDBj:8f7w
PDBsum8f7w
PubMed36638794
UniProtP41145|OPRK_HUMAN Kappa-type opioid receptor (Gene Name=OPRK1)

[Back to BioLiP]