Structure of PDB 8e3y Chain R Binding Site BS01

Receptor Information
>8e3y Chain R (length=372) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLA
CPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQ
TMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMHLFISF
ILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLV
EGLYLYTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGC
WDTINSSLWWIIKGPILTSILVNFILFICIIRILLQKLRPPDIRKSDSSP
YSRLARSTLLLIPLFGVHYIMFAFFPDNFKPEVKMVFELVVGSFQGFVVA
ILYCFLNGEVQAELRRKWRRWH
Ligand information
>8e3y Chain P (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSDGIFTDSYSRYRKQMAVKKYLAAVL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e3y Understanding VPAC receptor family peptide binding and selectivity
Resolution2.3 Å
Binding residue
(original residue number in PDB)		V40 I89 F93 K127 Q135 T136 Y139 V142 Y146 K195 F200 E204 F222 Q223 V226 D287 T288 I289 N290 W294 I297 D362 K369 M370 E373 L374
Binding residue
(residue number reindexed from 1)		V5 I54 F58 K92 Q100 T101 Y104 V107 Y111 K160 F165 E169 F187 Q188 V191 D252 T253 I254 N255 W259 I262 D327 K334 M335 E338 L339
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004999 vasoactive intestinal polypeptide receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e3y, PDBe:8e3y, PDBj:8e3y
PDBsum8e3y
PubMed36385145
UniProtP32241|VIPR1_HUMAN Vasoactive intestinal polypeptide receptor 1 (Gene Name=VIPR1)

[Back to BioLiP]