Structure of PDB 8e3x Chain R Binding Site BS01

Receptor Information
>8e3x Chain R (length=362) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMV
LVSCPELFRIFNPDVSRNCTEDGWSEPFPHYFDACGFDEQDYYYLSVKAL
YTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIK
DWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLV
ETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALW
WVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTL
LLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGE
VQAEIKRKWRSW
Ligand information
>8e3x Chain P (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSDGIFTDSYSRYRKQMAVKKYLAAVL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e3x Understanding VPAC receptor family peptide binding and selectivity
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K28 Q31 N60 F81 I83 F84 F136 D147 Y150 Y157 Y161 R199 K206 Y211 F220 F233 V237 Y241 D298 M299 N300 W306 E374 R381 L382 E385 L386
Binding residue
(residue number reindexed from 1)		K5 Q8 N37 F58 I60 F61 F87 D91 Y94 Y101 Y105 R143 K150 Y155 F164 F177 V181 Y185 D242 M243 N244 W250 E318 R325 L326 E329 L330
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004999 vasoactive intestinal polypeptide receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e3x, PDBe:8e3x, PDBj:8e3x
PDBsum8e3x
PubMed36385145
UniProtP41586|PACR_HUMAN Pituitary adenylate cyclase-activating polypeptide type I receptor (Gene Name=ADCYAP1R1)

[Back to BioLiP]