Structure of PDB 8dwc Chain R Binding Site BS01

Receptor Information
>8dwc Chain R (length=250) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CYKQTLSLTVLTCIVSLVGLTGNAVVLWLLGCRMRRNAFSIYILNLAAAD
FLFLSGRLIYSLLSFISIPHTISKILYPVMMFSYFAGLSFLSAVSTERCL
SVLWPIWYRCHRPTHLSAVVCVLLWALSLLRSILEWMLCGFLFSGADSAW
CQTSDFITVAWLIFLCVVLCGSSLVLLIRILCLTRLYVTILLTVLVFLLC
GLPFGIQFFLFLWIHVDREVLFCHVHLVSIFLSALNSSANPIIYFFVGSF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dwc Ligand recognition and allosteric modulation of the human MRGPRX1 receptor.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		Y99 P100 E157 C161 L240 W241 F250 H254
Binding residue
(residue number reindexed from 1)		Y77 P78 E135 C139 L212 W213 F222 H226
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0006953 acute-phase response
GO:0007165 signal transduction
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:1902349 response to chloroquine
Cellular Component
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dwc, PDBe:8dwc, PDBj:8dwc
PDBsum8dwc
PubMed36302898
UniProtQ96LB2|MRGX1_HUMAN Mas-related G-protein coupled receptor member X1 (Gene Name=MRGPRX1)

[Back to BioLiP]