Structure of PDB 8c6j Chain R Binding Site BS01

Receptor Information
>8c6j Chain R (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYNGIGLPTPRGSGTNGYVQRNLSLVRPNPDILDHERKRRVELRCLELEE
MMEEQGYEEQQIQEKVATFRLMLLEK
Ligand information
>8c6j Chain 5 (length=113) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acucugguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagau
uuccguggagaggaacaacucugagucuuaacccaauuuuuugagccuug
ccuuggcaaggcu
<<<<.<<<<<<<<<<<<........<<<<<<<<...........>>>>>>
>>...>>>>>>>>>>>....>.>>>>.................<<<<<<<
<....>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c6j Regulation of 3' splice site selection after step 1 of splicing by spliceosomal C* proteins.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
R11 G12
Binding residue
(residue number reindexed from 1)
R11 G12
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0070742 C2H2 zinc finger domain binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8c6j, PDBe:8c6j, PDBj:8c6j
PDBsum8c6j
PubMed36867703
UniProtQ9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 (Gene Name=SRRM2)

[Back to BioLiP]