Structure of PDB 8bed Chain R Binding Site BS01

Receptor Information
>8bed Chain R (length=73) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VGNHTAKWMQDRSKKSPMELISEVPPIKVDGRIVACEGDTNPALGHPIEF
ICLDLNEPAICKYCGLRYVQDHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bed Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution.
Resolution2.03 Å
Binding residue
(original residue number in PDB)		G38 N39 H40 K43 M54
Binding residue
(residue number reindexed from 1)		G2 N3 H4 K7 M18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bed, PDBe:8bed, PDBj:8bed
PDBsum8bed
PubMed36585502
UniProtQ9M9M6|NDUS6_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial (Gene Name=At3g03070)

[Back to BioLiP]